PDB entry 2hq7

View 2hq7 on RCSB PDB site
Description: Crystal structure of Protein related to general stress protein 26(GS26) of B.subtilis (pyridoxinephosphate oxidase family) (NP_350077.1) from CLOSTRIDIUM ACETOBUTYLICUM at 2.00 A resolution
Class: oxidoreductase
Keywords: NP_350077.1, Protein related to general stress protein 26(GS26) of B.subtilis (pyridoxinephosphate oxidase family), Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI
Deposited on 2006-07-18, released 2006-08-15
The last revision prior to the SCOP 1.73 freeze date was dated 2006-08-15, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.193
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein, related to general stress protein 26(GS26) of B.subtilis
    Species: Clostridium acetobutylicum
    Gene: NP_350077.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97DI6
      • modified residue (21)
      • modified residue (36-37)
      • modified residue (57)
      • modified residue (81)
      • modified residue (97)
    Domains in SCOP 1.73: d2hq7a1
  • Chain 'B':
    Compound: Protein, related to general stress protein 26(GS26) of B.subtilis
    Species: Clostridium acetobutylicum
    Gene: NP_350077.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97DI6
      • modified residue (21)
      • modified residue (36-37)
      • modified residue (57)
      • modified residue (81)
      • modified residue (97)
    Domains in SCOP 1.73: d2hq7b1
  • Heterogens: CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hq7A (A:)
    gmidekfliesnelvesskivmvgtngengypnikammrlkhdglkkfwlstntstrmve
    rlkknnkiclyfvddnkfaglmlvgtieilhdraskemlwtdgceiyyplgiddpdytal
    cftaewgnyyrhlknitfkideiyny
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hq7A (A:)
    idekfliesnelvesskivmvgtngengypnikammrlkhdglkkfwlstntstrmverl
    kknnkiclyfvddnkfaglmlvgtieilhdraskemlwtdgceiyyplgiddpdytalcf
    taewgnyyrhlknitfkidei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hq7B (B:)
    gmidekfliesnelvesskivmvgtngengypnikammrlkhdglkkfwlstntstrmve
    rlkknnkiclyfvddnkfaglmlvgtieilhdraskemlwtdgceiyyplgiddpdytal
    cftaewgnyyrhlknitfkideiyny
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hq7B (B:)
    idekfliesnelvesskivmvgtngengypnikammrlkhdglkkfwlstntstrmverl
    kknnkiclyfvddnkfaglmlvgtieilhdraskemlwtdgceiyyplgiddpdytalcf
    taewgnyyrhlknitfkideiy