PDB entry 2hq1

View 2hq1 on RCSB PDB site
Description: Crystal Structure of ORF 1438 a putative Glucose/ribitol dehydrogenase from Clostridium thermocellum
Class: Oxidoreductase
Keywords: Glucose/ribitol dehydrogenase, CTH-1438, STRUCTURAL GENOMICS, SOUTHEAST COLLABORATORY FOR STRUCTURAL GENOMICS, SECSG, PSI, Protein Structure Initiative, Oxidoreductase
Deposited on 2006-07-18, released 2006-09-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.233
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucose/ribitol dehydrogenase
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2hq1a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hq1A (A:)
    mqlkgktaivtgssrglgkaiawklgnmganivlngspastsldataeefkaaginvvva
    kgdvknpedvenmvktamdafgridilvnnagitrdtlmlkmsekdwddvlntnlksayl
    ctkavskimlkqksgkiinitsiagiignagqanyaaskagligftksiakefaakgiyc
    navapgiiktdmtdvlpdkvkemylnniplkrfgtpeevanvvgflasddsnyitgqvin
    idgglvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hq1A (A:)
    mqlkgktaivtgssrglgkaiawklgnmganivlngspastsldataeefkaaginvvva
    kgdvknpedvenmvktamdafgridilvnnawddvlntnlksaylctkavskimlkqksg
    kiinitsqanyaaskagligftksiakefaakgiycnavapgiiktdmtdvlpdkvkemy
    lnniplkrfgtpeevanvvgflasddsnyitgqvinidggl