PDB entry 2hpr

View 2hpr on RCSB PDB site
Description: histidine-containing phosphocarrier protein hpr mutant with met 51 replaced by val and ser 83 replaced by cys (m51v, s83c)
Class: phosphotransferase
Keywords: phosphotransferase
Deposited on 1992-09-09, released 1993-01-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.145
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histidine-containing phosphocarrier protein hpr
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08877 (0-86)
      • conflict (49)
      • conflict (81)
    Domains in SCOPe 2.05: d2hpra_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hprA (A:)
    aqktfkvtadsgiharpatvlvqtaskydadvnleyngktvnlksimgvvslgiakgaei
    tisasgadendalnaleetmkceglge