PDB entry 2hpf

View 2hpf on RCSB PDB site
Description: comparison of the structures of hiv-2 protease complexes in three crystal space groups with an hiv-1 protease complex structure
Deposited on 1994-09-21, released 1994-10-15
The last revision prior to the SCOP 1.61 freeze date was dated 1994-10-15, with a file datestamp of 1994-10-15.
Experiment type: -
Resolution: 3 Å
R-factor: 0.144
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d2hpfa_
  • Chain 'B':
    Domains in SCOP 1.61: d2hpfb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hpfA (A:)
    pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintleyk
    nveievlnkkvratimtgdtpinifgrniltalgmslnl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hpfB (B:)
    pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintleyk
    nveievlnkkvratimtgdtpinifgrniltalgmslnl