PDB entry 2hox

View 2hox on RCSB PDB site
Description: alliinase from allium sativum (garlic)
Class: lyase
Keywords: cysteine sulphoxide lyase, alliinase, lyase
Deposited on 2006-07-17, released 2007-02-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alliin lyase 1
    Species: Allium sativum [TaxId:4682]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01594 (0-End)
      • see remark 999 (175)
    Domains in SCOPe 2.08: d2hoxa_
  • Chain 'B':
    Compound: Alliin lyase 1
    Species: Allium sativum [TaxId:4682]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01594 (0-426)
      • see remark 999 (175)
    Domains in SCOPe 2.08: d2hoxb_
  • Chain 'C':
    Compound: Alliin lyase 1
    Species: Allium sativum [TaxId:4682]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01594 (0-End)
      • see remark 999 (175)
    Domains in SCOPe 2.08: d2hoxc_
  • Chain 'D':
    Compound: Alliin lyase 1
    Species: Allium sativum [TaxId:4682]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01594 (0-426)
      • see remark 999 (175)
    Domains in SCOPe 2.08: d2hoxd_
  • Heterogens: NAG, CL, P1T, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hoxA (A:)
    kmtwtmkaaeeaeavanincsehgrafldgiisegspkcecntcytgpdcsekiqgcsad
    vasgdglfleeywkqhkeasavlvspwhrmsyffnpvsnfisfelektikelhevvgnaa
    akdryivfgvgvtqlihglvislspnmtatpdapeskvvahapfypvfreqtkyfdkkgy
    vwagnaanyvnvsnpeqyiemvtspnnpegllrhavikgcksiydmvyywphytpikyka
    dedillftmskftghsgsrfgwalikdesvynnllnymtkntegtpretqlrslkvlkev
    vamvktqkgtmrdlntfgfkklrerwvnitalldqsdrfsyqelpqseycnyfrrmrpps
    psyawvkceweedkdcyqtfqngrintqngvgfeassryvrlsliktqddfdqlmyylkd
    mvkakrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hoxA (A:)
    kmtwtmkaaeeaeavanincsehgrafldgiisegspkcecntcytgpdcsekiqgcsad
    vasgdglfleeywkqhkeasavlvspwhrmsyffnpvsnfisfelektikelhevvgnaa
    akdryivfgvgvtqlihglvislspnmtatpdapeskvvahapfypvfreqtkyfdkkgy
    vwagnaanyvnvsnpeqyiemvtspnnpegllrhavikgcksiydmvyywphytpikyka
    dedillftmskftghsgsrfgwalikdesvynnllnymtkntegtpretqlrslkvlkev
    vamvktqkgtmrdlntfgfkklrerwvnitalldqsdrfsyqelpqseycnyfrrmrpps
    psyawvkceweedkdcyqtfqngrintqngvgfeassryvrlsliktqddfdqlmyylkd
    mvkak
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hoxB (B:)
    kmtwtmkaaeeaeavanincsehgrafldgiisegspkcecntcytgpdcsekiqgcsad
    vasgdglfleeywkqhkeasavlvspwhrmsyffnpvsnfisfelektikelhevvgnaa
    akdryivfgvgvtqlihglvislspnmtatpdapeskvvahapfypvfreqtkyfdkkgy
    vwagnaanyvnvsnpeqyiemvtspnnpegllrhavikgcksiydmvyywphytpikyka
    dedillftmskftghsgsrfgwalikdesvynnllnymtkntegtpretqlrslkvlkev
    vamvktqkgtmrdlntfgfkklrerwvnitalldqsdrfsyqelpqseycnyfrrmrpps
    psyawvkceweedkdcyqtfqngrintqngvgfeassryvrlsliktqddfdqlmyylkd
    mvkakrk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2hoxC (C:)
    kmtwtmkaaeeaeavanincsehgrafldgiisegspkcecntcytgpdcsekiqgcsad
    vasgdglfleeywkqhkeasavlvspwhrmsyffnpvsnfisfelektikelhevvgnaa
    akdryivfgvgvtqlihglvislspnmtatpdapeskvvahapfypvfreqtkyfdkkgy
    vwagnaanyvnvsnpeqyiemvtspnnpegllrhavikgcksiydmvyywphytpikyka
    dedillftmskftghsgsrfgwalikdesvynnllnymtkntegtpretqlrslkvlkev
    vamvktqkgtmrdlntfgfkklrerwvnitalldqsdrfsyqelpqseycnyfrrmrpps
    psyawvkceweedkdcyqtfqngrintqngvgfeassryvrlsliktqddfdqlmyylkd
    mvkakrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hoxC (C:)
    kmtwtmkaaeeaeavanincsehgrafldgiisegspkcecntcytgpdcsekiqgcsad
    vasgdglfleeywkqhkeasavlvspwhrmsyffnpvsnfisfelektikelhevvgnaa
    akdryivfgvgvtqlihglvislspnmtatpdapeskvvahapfypvfreqtkyfdkkgy
    vwagnaanyvnvsnpeqyiemvtspnnpegllrhavikgcksiydmvyywphytpikyka
    dedillftmskftghsgsrfgwalikdesvynnllnymtkntegtpretqlrslkvlkev
    vamvktqkgtmrdlntfgfkklrerwvnitalldqsdrfsyqelpqseycnyfrrmrpps
    psyawvkceweedkdcyqtfqngrintqngvgfeassryvrlsliktqddfdqlmyylkd
    mvkak
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hoxD (D:)
    kmtwtmkaaeeaeavanincsehgrafldgiisegspkcecntcytgpdcsekiqgcsad
    vasgdglfleeywkqhkeasavlvspwhrmsyffnpvsnfisfelektikelhevvgnaa
    akdryivfgvgvtqlihglvislspnmtatpdapeskvvahapfypvfreqtkyfdkkgy
    vwagnaanyvnvsnpeqyiemvtspnnpegllrhavikgcksiydmvyywphytpikyka
    dedillftmskftghsgsrfgwalikdesvynnllnymtkntegtpretqlrslkvlkev
    vamvktqkgtmrdlntfgfkklrerwvnitalldqsdrfsyqelpqseycnyfrrmrpps
    psyawvkceweedkdcyqtfqngrintqngvgfeassryvrlsliktqddfdqlmyylkd
    mvkakrk