PDB entry 2hoq

View 2hoq on RCSB PDB site
Description: Crystal structure of the probable haloacid dehalogenase (PH1655) from pyrococcus horikoshii OT3
Class: hydrolase
Keywords: HALOACID DEHALOGENASE, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, HYDROLASE
Deposited on 2006-07-16, released 2007-07-17
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.215
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative HAD-hydrolase PH1655
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2hoqa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hoqA (A:)
    mvkviffdlddtlvdtsklaeiarknaienmirhglpvdfetayselielikeygsnfpy
    hfdyllrrldlpynpkwisagviayhntkfaylrevpgarkvlirlkelgyelgiitdgn
    pvkqwekilrlelddffehviisdfegvkkphpkifkkalkafnvkpeealmvgdrlysd
    iygakrvgmktvwfrygkhsereleyrkyadyeidnlesllevlaresssnkkvhpprqq
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hoqA (A:)
    mvkviffdlddtlvdtsklaeiarknaienmirhglpvdfetayselielikeygsnfpy
    hfdyllrrldlpynpkwisagviayhntkfaylrevpgarkvlirlkelgyelgiitdgn
    pvkqwekilrlelddffehviisdfegvkkphpkifkkalkafnvkpeealmvgdrlysd
    iygakrvgmktvwfrygkhsereleyrkyadyeidnlesllevlaresssnkkvhpp