PDB entry 2hoi

View 2hoi on RCSB PDB site
Description: Crystal structure of the tetrameric pre-cleavage synaptic complex in the cre-loxp site-specific recombination
Class: recombination/DNA
Keywords: cre-loxp precleavage synapse, recombination-DNA complex
Deposited on 2006-07-14, released 2007-06-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Recombinase cre
    Species: Enterobacteria phage P1 [TaxId:10678]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06956
      • engineered (200)
    Domains in SCOPe 2.07: d2hoia1, d2hoia2
  • Chain 'B':
    Compound: Recombinase cre
    Species: Enterobacteria phage P1 [TaxId:10678]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06956
      • engineered (200)
    Domains in SCOPe 2.07: d2hoib1, d2hoib2
  • Chain 'C':
    Compound: LoxP DNA
  • Chain 'D':
    Compound: LoxP DNA
  • Chain 'E':
    Compound: LoxP DNA
  • Chain 'F':
    Compound: LoxP DNA
  • Chain 'G':
    Compound: Recombinase cre
    Species: Enterobacteria phage P1 [TaxId:10678]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06956
      • engineered (200)
    Domains in SCOPe 2.07: d2hoig1, d2hoig2
  • Chain 'H':
    Compound: Recombinase cre
    Species: Enterobacteria phage P1 [TaxId:10678]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06956
      • engineered (200)
    Domains in SCOPe 2.07: d2hoih1, d2hoih2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hoiA (A:)
    msnlltvhqnlpalpvdatsdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnn
    rkwfpaepedvrdyllylqarglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrri
    rkenvdagerakqalafertdfdqvrslmensdrcqdirnlaflgiayntllriaeiari
    rvkdisrtdggrmlihigrtatlvstagvekalslgvtklverwisvsgvaddpnnylfc
    rvrkngvaapsatsqlstralegifeathrliygakddsgqrylawsghsarvgaardma
    ragvsipeimqaggwtnvnivmnyirnldsetgamvrlledgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hoiA (A:)
    sdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylq
    arglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdagerakqalafer
    tdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtdggrmlihigr
    tatlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaapsatsqlstr
    alegifeathrliygakddsgqrylawsghsarvgaardmaragvsipeimqaggwtnvn
    ivmnyirnldsetgamvrlled
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hoiB (B:)
    msnlltvhqnlpalpvdatsdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnn
    rkwfpaepedvrdyllylqarglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrri
    rkenvdagerakqalafertdfdqvrslmensdrcqdirnlaflgiayntllriaeiari
    rvkdisrtdggrmlihigrtatlvstagvekalslgvtklverwisvsgvaddpnnylfc
    rvrkngvaapsatsqlstralegifeathrliygakddsgqrylawsghsarvgaardma
    ragvsipeimqaggwtnvnivmnyirnldsetgamvrlledgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hoiB (B:)
    sdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylq
    arglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdagerakqalafer
    tdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtdggrmlihigr
    tatlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaapsatsqlstr
    alegifeathrliygakddsgqrylawsghsarvgaardmaragvsipeimqaggwtnvn
    ivmnyirnldsetgamvrlled
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2hoiG (G:)
    msnlltvhqnlpalpvdatsdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnn
    rkwfpaepedvrdyllylqarglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrri
    rkenvdagerakqalafertdfdqvrslmensdrcqdirnlaflgiayntllriaeiari
    rvkdisrtdggrmlihigrtatlvstagvekalslgvtklverwisvsgvaddpnnylfc
    rvrkngvaapsatsqlstralegifeathrliygakddsgqrylawsghsarvgaardma
    ragvsipeimqaggwtnvnivmnyirnldsetgamvrlledgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hoiG (G:)
    sdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylq
    arglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdagerakqalafer
    tdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtdggrmlihigr
    tatlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaapsatsqlstr
    alegifeathrliygakddsgqrylawsghsarvgaardmaragvsipeimqaggwtnvn
    ivmnyirnldsetgamvrlled
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2hoiH (H:)
    msnlltvhqnlpalpvdatsdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnn
    rkwfpaepedvrdyllylqarglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrri
    rkenvdagerakqalafertdfdqvrslmensdrcqdirnlaflgiayntllriaeiari
    rvkdisrtdggrmlihigrtatlvstagvekalslgvtklverwisvsgvaddpnnylfc
    rvrkngvaapsatsqlstralegifeathrliygakddsgqrylawsghsarvgaardma
    ragvsipeimqaggwtnvnivmnyirnldsetgamvrlledgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hoiH (H:)
    sdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylq
    arglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdagerakqalafer
    tdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtdggrmlihigr
    tatlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaapsatsqlstr
    alegifeathrliygakddsgqrylawsghsarvgaardmaragvsipeimqaggwtnvn
    ivmnyirnldsetgamvrlled