PDB entry 2hoh
View 2hoh on RCSB PDB site
Description: ribonuclease t1 (n9a mutant) complexed with 2'gmp
Class: hydrolase
Keywords: endoribonuclease, ribonuclease, endonuclease, hydrolase
Deposited on
1998-09-14, released
1998-09-23
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.168
AEROSPACI score: 0.5
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: protein (ribonuclease t1)
Species: Aspergillus oryzae [TaxId:5062]
Database cross-references and differences (RAF-indexed):
- Uniprot P00651 (0-103)
- engineered (8)
- conflict (24)
Domains in SCOPe 2.08: d2hoha_ - Chain 'B':
Compound: protein (ribonuclease t1)
Species: Aspergillus oryzae [TaxId:5062]
Database cross-references and differences (RAF-indexed):
- Uniprot P00651 (0-103)
- engineered (8)
- conflict (24)
Domains in SCOPe 2.08: d2hohb_ - Chain 'C':
Compound: protein (ribonuclease t1)
Species: Aspergillus oryzae [TaxId:5062]
Database cross-references and differences (RAF-indexed):
- Uniprot P00651 (0-103)
- engineered (8)
- conflict (24)
Domains in SCOPe 2.08: d2hohc_ - Chain 'D':
Compound: protein (ribonuclease t1)
Species: Aspergillus oryzae [TaxId:5062]
Database cross-references and differences (RAF-indexed):
- Uniprot P00651 (0-103)
- engineered (8)
- conflict (24)
Domains in SCOPe 2.08: d2hohd_ - Heterogens: CA, NA, PO4, 2GP, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2hohA (A:)
acdytcgsacysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2hohB (B:)
acdytcgsacysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>2hohC (C:)
acdytcgsacysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>2hohD (D:)
acdytcgsacysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect