PDB entry 2hoh

View 2hoh on RCSB PDB site
Description: ribonuclease t1 (n9a mutant) complexed with 2'gmp
Class: hydrolase
Keywords: endoribonuclease, ribonuclease, endonuclease, hydrolase
Deposited on 1998-09-14, released 1998-09-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.168
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ribonuclease t1)
    Species: Aspergillus oryzae [TaxId:5062]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00651 (0-103)
      • engineered (8)
      • conflict (24)
    Domains in SCOPe 2.08: d2hoha_
  • Chain 'B':
    Compound: protein (ribonuclease t1)
    Species: Aspergillus oryzae [TaxId:5062]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00651 (0-103)
      • engineered (8)
      • conflict (24)
    Domains in SCOPe 2.08: d2hohb_
  • Chain 'C':
    Compound: protein (ribonuclease t1)
    Species: Aspergillus oryzae [TaxId:5062]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00651 (0-103)
      • engineered (8)
      • conflict (24)
    Domains in SCOPe 2.08: d2hohc_
  • Chain 'D':
    Compound: protein (ribonuclease t1)
    Species: Aspergillus oryzae [TaxId:5062]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00651 (0-103)
      • engineered (8)
      • conflict (24)
    Domains in SCOPe 2.08: d2hohd_
  • Heterogens: CA, NA, PO4, 2GP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hohA (A:)
    acdytcgsacysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
    ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hohB (B:)
    acdytcgsacysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
    ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hohC (C:)
    acdytcgsacysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
    ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hohD (D:)
    acdytcgsacysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
    ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect