PDB entry 2hog

View 2hog on RCSB PDB site
Description: crystal structure of Chek1 in complex with inhibitor 20
Class: transferase
Keywords: Chek1, kinase, cell cycle checkpoint
Deposited on 2006-07-14, released 2007-04-24
The last revision prior to the SCOP 1.73 freeze date was dated 2007-04-24, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.204
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase Chk1
    Species: HOMO SAPIENS
    Gene: CHEK1, CHK1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2hoga1
  • Heterogens: 710, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hogA (A:)
    avpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicinkm
    lnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvyl
    hgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkr
    refhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplal
    lhkilvenpsaritipdikkdrwynkplkkgakrprvtsggvsespsgfskhiqsnldfs
    pvnsasrtpgsgwskehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hogA (A:)
    avpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmknikkeicinkmlnhenvv
    kfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvylhgigith
    rdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrrefhaep
    vdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhkilve
    npsaritipdikkdrwynkplkkgakrprvts