PDB entry 2hob

View 2hob on RCSB PDB site
Description: Crystal structure of SARS-CoV main protease with authentic N and C-termini in complex with a Michael acceptor N3
Class: viral protein
Keywords: SARS-CoV, main protease, michael acceptor N3, VIRAL PROTEIN
Deposited on 2006-07-14, released 2007-04-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-12-09, with a file datestamp of 2015-12-04.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Replicase polyprotein 1ab
    Species: SARS coronavirus [TaxId:227859]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2hoba_
  • Chain 'B':
    Compound: n-[(5-methylisoxazol-3-yl)carbonyl]alanyl-l-valyl-n~1~-((1r,2z)-4-(benzyloxy)-4-oxo-1-{[(3r)-2-oxopyrrolidin-3-yl]methyl}but-2-enyl)-l-leucinamide
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 2HOB (0-5)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2hobA (A:)
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
sgvtfq

  • Chain 'B':
    No sequence available.