PDB entry 2ho4

View 2ho4 on RCSB PDB site
Description: Crystal Structure of Protein from Mouse Mm.236127
Class: hydrolase
Keywords: Haloacid dehalogenase-like hydrolase domain containing 2, Hdhd2, PROTEIN STRUCTURE INITIATIVE, PSI, CENTER FOR EUKARYOTIC STRUCTURAL GENOMICS, CESG, HYDROLASE
Deposited on 2006-07-13, released 2006-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Haloacid dehalogenase-like hydrolase domain containing 2
    Species: Mus musculus [TaxId:10090]
    Gene: Hdhd2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6PEB2 (Start-258)
      • modified residue (40)
      • modified residue (90)
      • missense mutation (93)
      • modified residue (174)
      • modified residue (200)
      • modified residue (217)
    Domains in SCOPe 2.07: d2ho4a_
  • Chain 'B':
    Compound: Haloacid dehalogenase-like hydrolase domain containing 2
    Species: Mus musculus [TaxId:10090]
    Gene: Hdhd2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6PEB2 (Start-258)
      • modified residue (40)
      • modified residue (90)
      • missense mutation (93)
      • modified residue (174)
      • modified residue (200)
      • modified residue (217)
    Domains in SCOPe 2.07: d2ho4b_
  • Heterogens: MG, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ho4A (A:)
    saarralkavlvdlngtlhiedaavpgaqealkrlratsvmvrfvtnttketkkdllerl
    kklefeisedeiftsltaarnlieqkqvrpmlllddralpeftgvqtqdpnavviglape
    hfhyqllnqafrllldgapliaihkaryykrkdglalgpgpfvtaleyatdtkamvvgkp
    ektfflealrdadcapeeavmigddcrddvdgaqnigmlgilvktgkykaadeekinppp
    yltcesfphavdhilqhll
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ho4A (A:)
    alkavlvdlngtlhiavpgaqealkrlratsvmvrfvtnttketkkdllerlkklefeis
    edeiftsltaarnlieqkqvrpmlllddralpeftgvqtqdpnavviglapehfhyqlln
    qafrllldgapliaihkaryykrkdglalgpgpfvtaleyatdtkamvvgkpektfflea
    lrdadcapeeavmigddcrddvdgaqnigmlgilvktgkykaadeekinpppyltcesfp
    havdhilqhll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ho4B (B:)
    saarralkavlvdlngtlhiedaavpgaqealkrlratsvmvrfvtnttketkkdllerl
    kklefeisedeiftsltaarnlieqkqvrpmlllddralpeftgvqtqdpnavviglape
    hfhyqllnqafrllldgapliaihkaryykrkdglalgpgpfvtaleyatdtkamvvgkp
    ektfflealrdadcapeeavmigddcrddvdgaqnigmlgilvktgkykaadeekinppp
    yltcesfphavdhilqhll
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ho4B (B:)
    lkavlvdlngtlhiedaavpgaqealkrlratsvmvrfvtnttketkkdllerlkklefe
    isedeiftsltaarnlieqkqvrpmlllddralpeftgvqtqdpnavviglapehfhyql
    lnqafrllldgapliaihkaryykrkdglalgpgpfvtaleyatdtkamvvgkpektffl
    ealrdadcapeavmigddcrddvdgaqnigmlgilvktgkykaadeekinpppyltcesf
    phavdhilqhll