PDB entry 2ho2

View 2ho2 on RCSB PDB site
Description: Structure of human FE65-WW domain in complex with hMena peptide.
Class: protein binding
Keywords: ww domain, beta sheet, fe65, protein binding
Deposited on 2006-07-13, released 2007-07-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.33 Å
R-factor: 0.174
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Amyloid beta A4 protein-binding family B member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: APBB1, FE65
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2ho2a1
  • Chain 'B':
    Compound: Protein enabled homolog
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ho2A (A:)
    gsdlpagwmrvqdtsgtyywhiptgttqweppgrasps
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ho2A (A:)
    sdlpagwmrvqdtsgtyywhiptgttqweppgr
    

  • Chain 'B':
    No sequence available.