PDB entry 2hnx

View 2hnx on RCSB PDB site
Description: Crystal Structure of aP2
Class: lipid binding protein
Keywords: fatty acid binding protein, LIPID BINDING PROTEIN
Deposited on 2006-07-13, released 2006-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.177
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Fatty acid-binding protein, adipocyte
  Species: Homo sapiens [TaxId:9606]
  Gene: FABP4
  Database cross-references and differences (RAF-indexed):
  • Uniprot P15090 (4-135)
    • cloning artifact (0-3)
  Domains in SCOPe 2.08: d2hnxa2, d2hnxa3
• Heterogens: PO4, PLM, ACY, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2hnxA (A:)
  rgshmcdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdvitikses
  tfknteisfilgqefdevtaddrkvkstitldggvlvhvqkwdgksttikrkreddklvv
  ecvmkgvtstrvyera