PDB entry 2hnp

View 2hnp on RCSB PDB site
Description: crystal structure of human protein tyrosine phosphatase 1b
Class: hydrolase(phosphorylation)
Keywords: hydrolase(phosphorylation)
Deposited on 1994-09-19, released 1994-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein-tyrosine phosphatase-1b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hnpa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hnpA (A:)
    memekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklh
    qedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslk
    caqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwp
    dfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkd
    pssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshedle
    pppehipppprppkrilephn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hnpA (A:)
    kefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhqedn
    dyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkcaqy
    wpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpdfgv
    pespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdpssv
    dikkvllemrkfrmgliqtadqlrfsylaviegakfim