PDB entry 2hmy

View 2hmy on RCSB PDB site
Description: binary complex of hhai methyltransferase with adomet formed in the presence of a short nonpsecific dna oligonucleotide
Deposited on 1999-02-08, released 1999-03-19
The last revision prior to the SCOP 1.57 freeze date was dated 1999-03-19, with a file datestamp of 1999-03-23.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: 0.198
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Domains in SCOP 1.57: d2hmyb_

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hmyB (B:)
    mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
    itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
    vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
    qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
    iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
    qfgnsvvinvlqyiaynigsslnfkpy