PDB entry 2hmx

View 2hmx on RCSB PDB site
Description: human immunodeficiency virus type 1 matrix protein
Class: matrix protein
Keywords: hiv-1 p17, hiv-1 ma, matrix protein
Deposited on 1995-09-22, released 1996-01-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human immunodeficiency virus type 1 matrix protein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hmxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hmxA (A:)
    hmgarasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrq
    ilgqlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaa
    adtgnnsqvsqny