PDB entry 2hmv

View 2hmv on RCSB PDB site
Description: Diamond-shaped octameric ring structure of an RCK domain with ADP bound
Class: transport protein
Keywords: RCK, KTN, KTR, KTRA, KTRAB, membrane protein, ion transporter, symporter, TRANSPORT PROTEIN
Deposited on 2006-07-11, released 2006-09-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: YuaA protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yuaA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32080 (Start-143)
      • engineered (21)
    Domains in SCOPe 2.08: d2hmva_
  • Chain 'B':
    Compound: YuaA protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yuaA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32080
      • engineered (21)
    Domains in SCOPe 2.08: d2hmvb_
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hmvA (A:)
    mgriknkqfaviglgrfggsivkelhrmghevlavdineekvnayasyathavianatee
    nellslgirnfeyvivaiganiqastlttlllkeldipniwvkaqnyyhhkvlekigadr
    iihpekdmgvkiaqslsdenvlny
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hmvA (A:)
    nkqfaviglgrfggsivkelhrmghevlavdineekvnayasyathavianateenells
    lgirnfeyvivaiganiqastlttlllkeldipniwvkaqnyyhhkvlekigadriihpe
    kdmgvkiaqslsdenvlny
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hmvB (B:)
    mgriknkqfaviglgrfggsivkelhrmghevlavdineekvnayasyathavianatee
    nellslgirnfeyvivaiganiqastlttlllkeldipniwvkaqnyyhhkvlekigadr
    iihpekdmgvkiaqslsdenvlny
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hmvB (B:)
    kqfaviglgrfggsivkelhrmghevlavdineekvnayasyathavianateenellsl
    girnfeyvivaiganiqastlttlllkeldipniwvkaqnyyhhkvlekigadriihpek
    dmgvkiaqslsdenv