PDB entry 2hmi

View 2hmi on RCSB PDB site
Description: hiv-1 reverse transcriptase/fragment of fab 28/DNA complex
Class: immune system/DNA
Keywords: aids, hiv-1, rt, polymerase, immune system/DNA complex
Deposited on 1998-04-10, released 1998-10-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.271
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: subunit of v-1 reverse transcriptase
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03366 (0-557)
      • engineered (279)
    Domains in SCOPe 2.06: d2hmia1, d2hmia2
  • Chain 'B':
    Compound: hisubunit of v-1 reverse transcriptase
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03366 (0-429)
      • engineered (279)
    Domains in SCOPe 2.06: d2hmib_
  • Chain 'C':
    Compound: fab fragment of monoclonal antibody 28
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2HMI (0-213)
    Domains in SCOPe 2.06: d2hmic1, d2hmic2
  • Chain 'D':
    Compound: fab fragment of monoclonal antibody 28
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2HMI (0-219)
    Domains in SCOPe 2.06: d2hmid1, d2hmid2
  • Chain 'E':
    Compound: DNA (5'-d(*ap*tp*gp*gp*cp*gp*cp*cp*cp*gp*ap*ap*cp*ap*gp*gp*gp*ap*c)-3')
  • Chain 'F':
    Compound: DNA (5'-d(*gp*tp*cp*cp*cp*tp*gp*tp*tp*cp*gp*gp*gp*cp*gp*cp*cp*a)-3')

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hmiA (A:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelq
    aiylalqdsglevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahk
    giggneqvdklvsagirk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hmiB (B:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqle
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hmiC (C:)
    diqmtqttsslsaslgdrvtiscsasqdissylnwyqqkpegtvklliyytsslhsgvps
    afsgsgsgtdysltisnlepedfatyycqqyskfpwtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvawaidgsaaangvlnswtdqdskdstysmsstlt
    ltadeyeaansytcaathktstspivksfnanec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hmiD (D:)
    qitlkesgpgivqpsqpfrltctfsgfslstsgigvtwirqpsgkglewlatiwwdddnr
    ynpslksrltvskdtsnnqaflnmmtvetadtaiyycaqsaitsvtdsamdhwgqgtsvt
    vssaattppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavl
    qsdlytlsssvtvpsstwpsetvtcnvahpasstkvdkki
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.