PDB entry 2hm8

View 2hm8 on RCSB PDB site
Description: Solution Structure of the C-terminal MA-3 domain of Pdcd4
Class: apoptosis
Keywords: atypical HEAT domain, APOPTOSIS
Deposited on 2006-07-11, released 2007-02-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2008-12-23, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Pdcd4 C-terminal MA-3 domain
  Species: Mus musculus [TaxId:10090]
  Gene: Pdcd4, MA-3
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q61823 (5-135)
    • insertion (0-4)
  Domains in SCOPe 2.05: d2hm8a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2hm8A (A:)
  gplgsggqqpvnhlvkeidmllkeyllsgdiseaehclkelevphfhhelvyeaivmvle
  stgesafkmildllkslwksstitidqmkrgyeriyneipdinldvphsysvlerfveec
  fqagiiskqlrdlcps