PDB entry 2hm8

View 2hm8 on RCSB PDB site
Description: Solution Structure of the C-terminal MA-3 domain of Pdcd4
Class: apoptosis
Keywords: atypical HEAT domain, APOPTOSIS
Deposited on 2006-07-11, released 2007-02-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2008-12-23, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pdcd4 C-terminal MA-3 domain
    Species: Mus musculus [TaxId:10090]
    Gene: Pdcd4, MA-3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q61823 (5-135)
      • insertion (0-4)
    Domains in SCOPe 2.08: d2hm8a1, d2hm8a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hm8A (A:)
    gplgsggqqpvnhlvkeidmllkeyllsgdiseaehclkelevphfhhelvyeaivmvle
    stgesafkmildllkslwksstitidqmkrgyeriyneipdinldvphsysvlerfveec
    fqagiiskqlrdlcps