PDB entry 2hm2

View 2hm2 on RCSB PDB site
Description: Solution structure of ASC2
Class: apoptosis
Keywords: pyrin domain, six helix bundle, APOPTOSIS
Deposited on 2006-07-11, released 2006-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'Q':
    Compound: Pyrin-only protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: POP1, PYDC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hm2q_

PDB Chain Sequences:

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hm2Q (Q:)
    mgtkreailkvlenltpeelkkfkmklgtvplregferiprgalgqldivdltdklvasy
    yedyaaelvvavlrdmrmleeaarlqraa