PDB entry 2hlu

View 2hlu on RCSB PDB site
Description: Solution Structure of Bacillus subtilis Acylphosphatase
Class: hydrolase
Keywords: alpha/beta sandwich, HYDROLASE
Deposited on 2006-07-10, released 2007-07-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Probable acylphosphatase
  Species: Bacillus subtilis [TaxId:1423]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O35031 (0-90)
  Domains in SCOPe 2.08: d2hlua_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2hluA (A:)
  mlqyriivdgrvqgvgfryfvqmeadkrklagwvknrddgrveilaegpenalqsfveav
  kngspfskvtdisvtesrsleghhrfsivys