PDB entry 2hlp

View 2hlp on RCSB PDB site
Description: crystal structure of the e267r mutant of a halophilic malate dehydrogenase in the apo form
Deposited on 1999-04-23, released 2000-02-04
The last revision prior to the SCOP 1.55 freeze date was dated 2000-02-04, with a file datestamp of 2000-02-04.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: 0.194
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hlpA (A:)
    tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
    rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn
    pvdllnrhlyeagdrsreqvigfggrldsarfryvlseefdapvqnvegtilgehgdaqv
    pvfskvrvdgtdpefsgdekeqllgdlqesamdvierkgatewgpargvahmveailhdt
    grvlpasvklegefghedtafgvpvrlgsngveeivewdlddyeqdlmadaaeklsdqyd
    kis
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hlpB (B:)
    tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
    rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn
    pvdllnrhlyeagdrsreqvigfggrldsarfryvlseefdapvqnvegtilgehgdaqv
    pvfskvrvdgtdpefsgdekeqllgdlqesamdvierkgatewgpargvahmveailhdt
    grvlpasvklegefghedtafgvpvrlgsngveeivewdlddyeqdlmadaaeklsdqyd
    kis