PDB entry 2hlj

View 2hlj on RCSB PDB site
Description: crystal structure of a putative thioesterase (kt2440) from pseudomonas putida kt2440 at 2.00 a resolution
Class: hydrolase
Keywords: putative thioesterase, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi-2, hydrolase
Deposited on 2006-07-07, released 2006-08-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.17
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Pseudomonas putida [TaxId:160488]
    Gene: NP_742468.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q88R33 (1-156)
      • leader sequence (0)
      • modified residue (1)
      • modified residue (39)
      • modified residue (110)
      • modified residue (148)
    Domains in SCOPe 2.03: d2hlja1
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2hljA (A:)
gmpalityrttvqedwvdynghlrdafyllifsyatdalmdrigldadsrgqsgnslftl
eahinylhevklgtevwvqtqilgfdrkrlhvyhslhragfdevlaaseqmllhvdlagp
qsapfghttvcrlnhlveqqegaqapqymgrtiklpa

    Sequence, based on observed residues (ATOM records): (download) 
    >2hljA (A:)
gmpalityrttvqedwvdynghlrdafyllifsyatdalmdrigldadsrgqsgnslftl
eahinylhevklgtevwvqtqilgfdrkrlhvyhslhragfdevlaaseqmllhvdlqsa
pfghttvcrlnhlveqqegaqapqymgrtiklpa