PDB entry 2hle

View 2hle on RCSB PDB site
Description: Structural and biophysical characterization of the EPHB4-EPHRINB2 protein protein interaction and receptor specificity.
Class: transferase/transferase receptor
Keywords: Protein-protein interaction, Receptor tryosine kinase, Bi-directional cell signaling, TRANSFERASE-TRANSFERASE RECEPTOR COMPLEX, Structural Genomics, PSI-2, Protein Structure Initiative, Accelerated Technologies Center for Gene to 3D Structure, ATCG3D
Deposited on 2006-07-06, released 2006-08-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.229
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ephrin type-B receptor 4
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHB4, HTK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54760 (8-187)
      • cloning artifact (0-1)
      • expression tag (2-7)
    Domains in SCOPe 2.08: d2hlea1, d2hlea2
  • Chain 'B':
    Compound: ephrin-b2
    Species: Homo sapiens [TaxId:9606]
    Gene: EFNB2, EPLG5, HTKL, LERK5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52799 (0-137)
      • conflict (75)
      • conflict (80)
    Domains in SCOPe 2.08: d2hleb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hleA (A:)
    aghhhhhheetllntkletadlkwvtfpqvdgqweelsgldeeqhsvrtyevcdvqrapg
    qahwlrtgwvprrgavhvyatlrftmleclslpragrscketftvfyyesdadtataltp
    awmenpyikvdtvaaehltrkrpgaeatgkvnvktlrlgplskagfylafqdqgacmall
    slhlfykk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hleB (B:)
    ivlepiywnssnskflpgqglvlypqigdkldiicpkvdsktvgqyeyykvymvdkdqad
    rctikkentpllncarpdqdvkftikfqefspnlwglefqknkdyyiistsngslegldn
    qeggvcqtramkilmkvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hleB (B:)
    ivlepiywnssnskflpgqglvlypqigdkldiicpkvdsktvqyeyykvymvdkdqadr
    ctikpllncarpdqdvkftikfqefspnlwglefqknkdyyiistsngslegldnqeggv
    cqtramkilmkvg