PDB entry 2hl9

View 2hl9 on RCSB PDB site
Description: SUMO protease Ulp1 with the catalytic cysteine oxidized to a sulfonic acid
Class: hydrolase
Keywords: hydrolase
Deposited on 2006-07-06, released 2007-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.192
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-like-specific protease 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02724 (2-220)
      • expression tag (1)
    Domains in SCOPe 2.07: d2hl9a2, d2hl9a3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hl9A (A:)
    gslvpelnekdddqvqkalasrentqlmnrdnieitvrdfktlaprrwlndtiieffmky
    iekstpntvafnsffytnlsergyqgvrrwmkrkktqidkldkiftpinlnqshwalgii
    dlkkktigyvdslsngpnamsfailtdlqkyvmeeskhtigedfdlihldcpqqpngydc
    giyvcmntlygsadapldfdykdairmrrfiahliltdalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hl9A (A:)
    slvpelnekdddqvqkalasrentqlmnrieitvrdfktlaprrwlndtiieffmkyiek
    stpntvafnsffytnlsergyqgvrrwmkrkktqidkldkiftpinlnqshwalgiidlk
    kktigyvdslsngpnamsfailtdlqkyvmeeskhtigedfdlihldcpqqpngydcgiy
    vcmntlygsadapldfdykdairmrrfiahliltdalk