PDB entry 2hl6

View 2hl6 on RCSB PDB site
Description: Structure of homologously expressed Ferrulate esterase of Aspergillus niger in complex with CAPS
Class: hydrolase
Keywords: Esterase, a/b hydrolase fold, glycosylated, CAPS, HYDROLASE
Deposited on 2006-07-06, released 2006-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.165
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: feruloyl esterase a
    Species: Aspergillus niger [TaxId:5061]
    Gene: faeA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O42807 (0-259)
      • see remark 999 (202-203)
    Domains in SCOPe 2.07: d2hl6a_
  • Chain 'B':
    Compound: feruloyl esterase a
    Species: Aspergillus niger [TaxId:5061]
    Gene: faeA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O42807 (0-259)
      • see remark 999 (202-203)
    Domains in SCOPe 2.07: d2hl6b_
  • Heterogens: SO4, EDO, CXS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hl6A (A:)
    astqgisedlynrlvematisqaayadlcnipstiikgekiynaqtdingwilrddtske
    iitvfrgtgsdtnlqldtnytltpfdtlpqcndcevhggyyigwisvqdqveslvkqqas
    qypdyaltvtghslgasmaaltaaqlsatydnvrlytfgeprsgnqafasymndafqvss
    pettqyfrvthsndgipnlppaeqgyahggveywsvdpysaqntfvctgdevqcceaqgg
    qgvndahttyfgmtsgactw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hl6B (B:)
    astqgisedlynrlvematisqaayadlcnipstiikgekiynaqtdingwilrddtske
    iitvfrgtgsdtnlqldtnytltpfdtlpqcndcevhggyyigwisvqdqveslvkqqas
    qypdyaltvtghslgasmaaltaaqlsatydnvrlytfgeprsgnqafasymndafqvss
    pettqyfrvthsndgipnlppaeqgyahggveywsvdpysaqntfvctgdevqcceaqgg
    qgvndahttyfgmtsgactw