PDB entry 2hl2

View 2hl2 on RCSB PDB site
Description: Crystal structure of the editing domain of threonyl-tRNA synthetase from Pyrococcus abyssi in complex with an analog of seryladenylate
Class: ligase
Keywords: translation, editing, aminoacyl-tRNA synthetase, enzyme mechanism, enantioselectivity, LIGASE
Deposited on 2006-07-06, released 2006-08-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.213
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: threonyl-tRNA synthetase
    Species: Pyrococcus abyssi [TaxId:29292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2hl2a_
  • Chain 'B':
    Compound: threonyl-tRNA synthetase
    Species: Pyrococcus abyssi [TaxId:29292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2hl2b_
  • Heterogens: SSA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hl2A (A:)
    mrvllihsdyieyevkdkalknpepisedmkrgrmeevlvafisvekvdeknpeevslka
    ieeiskvaeqvkaenvfvypfahlsselakpsvamdilnrvyqglkergfnvgkapfgyy
    kafkisckghplaelsrtivpee
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hl2B (B:)
    mrvllihsdyieyevkdkalknpepisedmkrgrmeevlvafisvekvdeknpeevslka
    ieeiskvaeqvkaenvfvypfahlsselakpsvamdilnrvyqglkergfnvgkapfgyy
    kafkisckghplaelsrtivpee