PDB entry 2hky

View 2hky on RCSB PDB site
Description: NMR solution structure of human RNase 7
Class: hydrolase
Keywords: RNase, antimicrobial activity, HYDROLASE
Deposited on 2006-07-06, released 2006-12-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ribonuclease 7
  Species: Homo sapiens [TaxId:9606]
  Gene: RNASE7
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9H1E1 (1-128)
    • cloning artifact (0)
  Domains in SCOPe 2.08: d2hkya1, d2hkya2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2hkyA (A:)
  mkpkgmtssqwfkiqhmqpspqacnsamkninkhtkrckdlntflhepfssvaatcqtpk
  iackngdknchqshgpvsltmckltsgkypncrykekrqnksyvvackppqkkdsqqfhl
  vpvhldrvl