PDB entry 2hkv

View 2hkv on RCSB PDB site
Description: crystal structure of a putative member of the dinb family (exig_1237) from exiguobacterium sibiricum 255-15 at 1.70 a resolution
Class: DNA binding protein
Keywords: putative member of the dinb family, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi-2, DNA binding protein
Deposited on 2006-07-05, released 2006-08-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Exiguobacterium sibiricum [TaxId:262543]
    Gene: ZP_00537729.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q41IB9 (1-End)
      • leader sequence (0)
      • modified residue (1)
      • modified residue (68)
      • modified residue (97)
    Domains in SCOPe 2.08: d2hkva1, d2hkva2
  • Heterogens: NI, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hkvA (A:)
    gmtdwqqaldrhvgvgvrttrdlirliqpedwdkrpisgkrsvyevavhlavlleadlri
    atgatademaqfyavpvlpeqlvdrldqswqyyqdrlmadfstettywgvtdsttgwlle
    aavhlyhhrsqlldylnllgydikldlfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hkvA (A:)
    gmtdwqqaldrhvgvgvrttrdlirliqpedwdkrpisgkrsvyevavhlavlleadlri
    atgatademaqfyavpvlpeqlvdrldqswqyyqdrlmadfstettywgvtdsttgwlle
    aavhlyhhrsqlldylnllgydikldlf