PDB entry 2hkq

View 2hkq on RCSB PDB site
Description: Crystal structure of the C-terminal domain of human EB1 in complex with the CAP-Gly domain of human Dynactin-1 (p150-Glued)
Class: structural protein
Keywords: microtubule binding, dynactin, cytoskeleton associated protein, p150Glued, EB1, +TIP protein Complex structure, structural protein
Deposited on 2006-07-05, released 2006-09-12
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.179
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Microtubule-associated protein RP/EB family member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPRE1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2hkqa_
  • Chain 'B':
    Compound: Dynactin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: DCTN1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hkqA (A:)
    gsdeaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilya
    tdegfvipdeggpqeeqeey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hkqA (A:)
    eaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilyatde
    gfvi
    

  • Chain 'B':
    No sequence available.