PDB entry 2hkp

View 2hkp on RCSB PDB site
Description: SUMO protease Ulp1 with the catalytic cysteine oxidized to a sulfenic acid
Class: hydrolase
Keywords: hydrolase
Deposited on 2006-07-05, released 2007-07-31
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.216
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-like-specific protease 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02724 (2-220)
      • expression tag (0-1)
    Domains in SCOPe 2.03: d2hkpa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hkpA (A:)
    gslvpelnekdddqvqkalasrentqlmnrdnieitvrdfktlaprrwlndtiieffmky
    iekstpntvafnsffytnlsergyqgvrrwmkrkktqidkldkiftpinlnqshwalgii
    dlkkktigyvdslsngpnamsfailtdlqkyvmeeskhtigedfdlihldcpqqpngydc
    giyvcmntlygsadapldfdykdairmrrfiahliltdalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hkpA (A:)
    gslvpelnekdddqvqkalasrtqlmnrdnieitvrdfktlaprrwlndtiieffmkyie
    kstpntvafnsffytnlsergyqgvrrwmkrkktqidkldkiftpinlnqshwalgiidl
    kkktigyvdslsngpnamsfailtdlqkyvmeeskhtigedfdlihldcpqqpngydcgi
    yvcmntlygsadapldfdykdairmrrfiahliltdalk