PDB entry 2hkl

View 2hkl on RCSB PDB site
Description: Crystal structure of Enterococcus faecium L,D-transpeptidase C442S mutant
Class: transferase
Keywords: l,d-transpeptidase, antibiotic resistance, TRANSFERASE
Deposited on 2006-07-05, released 2007-05-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.216
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L,D-transpeptidase
    Species: Enterococcus faecium [TaxId:1352]
    Gene: ldtfm
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3Y185 (0-249)
      • engineered (225)
    Domains in SCOPe 2.08: d2hkla1, d2hkla2
  • Chain 'B':
    Compound: L,D-transpeptidase
    Species: Enterococcus faecium [TaxId:1352]
    Gene: ldtfm
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3Y185 (0-249)
      • engineered (225)
    Domains in SCOPe 2.08: d2hklb1, d2hklb2
  • Chain 'C':
    Compound: L,D-transpeptidase
    Species: Enterococcus faecium [TaxId:1352]
    Gene: ldtfm
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3Y185 (0-249)
      • engineered (225)
    Domains in SCOPe 2.08: d2hklc1, d2hklc2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hklA (A:)
    keqlasmnaianvkatysingetfqipssdimswltyndgkvdldteqvrqyvtdlgtky
    ntstndtkfkstkrgevtvpvgtyswtiqtdsetealkkailagqdftrspivqggttad
    hpliedtyievdlenqhmwyykdgkvaletdivsgkpttptpagvfyvwnkeedatlkgt
    nddgtpyespvnywmpidwtgvgihdsdwqpeyggdlwktrgshgsintppsvmkelfgm
    vekgtpvlvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hklA (A:)
    keqlasmnaianvkatysingetfqipssdimswltyndgkvdldteqvrqyvtdlgtky
    ntstndtkfkstkrgevtvpvgtyswtiqtdsetealkkailagqdftrspivqggttad
    hpliedtyievdlenqhmwyykdgkvaletdivsgkpttptpagvfyvwnkeedatlkgt
    ngtpyespvnywmpidwtgvgihdsdwqpeyggdlwktrgshgsintppsvmkelfgmve
    kgtpvlvf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hklB (B:)
    keqlasmnaianvkatysingetfqipssdimswltyndgkvdldteqvrqyvtdlgtky
    ntstndtkfkstkrgevtvpvgtyswtiqtdsetealkkailagqdftrspivqggttad
    hpliedtyievdlenqhmwyykdgkvaletdivsgkpttptpagvfyvwnkeedatlkgt
    nddgtpyespvnywmpidwtgvgihdsdwqpeyggdlwktrgshgsintppsvmkelfgm
    vekgtpvlvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hklB (B:)
    keqlasmnaianvkatysingetfqipssdimswltyndgkvdldteqvrqyvtdlgtky
    ntstndtkfkstkrgevtvpvgtyswtiqtdsetealkkailagqdftrspivqggttad
    hpliedtyievdlenqhmwyykdgkvaletdivsgkpttptpagvfyvwnkeedatlkgt
    ngtpyespvnywmpidwtgvgihdsdwqpeyggdlwktrgshgsintppsvmkelfgmve
    kgtpvlvf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2hklC (C:)
    keqlasmnaianvkatysingetfqipssdimswltyndgkvdldteqvrqyvtdlgtky
    ntstndtkfkstkrgevtvpvgtyswtiqtdsetealkkailagqdftrspivqggttad
    hpliedtyievdlenqhmwyykdgkvaletdivsgkpttptpagvfyvwnkeedatlkgt
    nddgtpyespvnywmpidwtgvgihdsdwqpeyggdlwktrgshgsintppsvmkelfgm
    vekgtpvlvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hklC (C:)
    keqlasmnaianvkatysingetfqipssdimswltyndgkvdldteqvrqyvtdlgtky
    ntstndtkfkstkrgevtvpvgtyswtiqtdsetealkkailagqdftrspivqggttad
    hpliedtyievdlenqhmwyykdgkvaletdivsgkpttptpagvfyvwnkeedatlkgt
    ngtpyespvnywmpidwtgvgihdsdwqpeyggdlwktrgshgsintppsvmkelfgmve
    kgtpvlvf