PDB entry 2hkj

View 2hkj on RCSB PDB site
Description: Topoisomerase VI-B bound to radicicol
Class: isomerase
Keywords: topoisomerase, ghkl, drug complex, radicicol
Deposited on 2006-07-04, released 2006-08-29
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-03, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.17
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type II DNA topoisomerase VI subunit B
    Species: Sulfolobus shibatae
    Gene: top6B
    Database cross-references and differences (RAF-indexed):
    • Uniprot O05207 (Start-468)
      • see remark 999 (301)
      • see remark 999 (433)
    Domains in SCOP 1.73: d2hkja1, d2hkja2, d2hkja3
  • Heterogens: MG, DMS, RDC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hkjA (A:)
    sakekftslspaeffkrnpelagfpnparalyqtvreliensldatdvhgilpnikitid
    liddarqiykvnvvdngigippqevpnafgrvlysskyvnrqtrgmyglgvkaavlysqm
    hqdkpieietspvnskriytfklkidinknepiivergsventrgfhgtsvaisipgdwp
    kaksriyeyikrtyiitpyaefifkdpegnvtyyprltnkipkppqevkphpygvdreei
    kilinnlkrdytikeflvnefqsigdttadkilelaglkpnkkvknlteeeitrlvetfk
    kyedfrspsadslsvigedlielglkkifnpdfaasitrkpkayqghpfiveagvafggs
    ipvgeepivlryankipliydeksdviwkvveeldwkrygiesdqyqmvvmvhlcstkip
    yksagkesiaevediekeiknalmevarklkqylsekrkeqeakkklla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hkjA (A:)
    lspaeffkrnpelagfpnparalyqtvreliensldatdvhgilpnikitidliddarqi
    ykvnvvdngigippqevpnafgrvlysskyvnrqtrgmyglgvkaavlysqmhqdkpiei
    etspvnskriytfklkidinknepiivergsventrgfhgtsvaisipgdwpkaksriye
    yikrtyiitpyaefifkdpegnvtyyprltnkipkppqevkphpygvdreeikilinnlk
    rdytikeflvnefqsigdttadkilelaglkpnkkvknlteeeitrlvetfkkyedfrsp
    sadslsvigedlielglkkifnpdfaasitrkpkayqghpfiveagvafggsipvgeepi
    vlryankipliydeksdviwkvveeldwkrygiesdqyqmvvmvhlcstkipyksagkes
    iaevediekeiknalmevarklkqylsekrkeqeakkklla