PDB entry 2hki

View 2hki on RCSB PDB site
Description: Crystal structure of photosynthetic glyceraldehyde-3-phosphate dehydrogenase A4 isoform
Class: oxidoreductase
Keywords: rossmann fold, apo-form, OXIDOREDUCTASE
Deposited on 2006-07-04, released 2006-11-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.212
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glyceraldehyde-3-phosphate dehydrogenase A, chloroplast
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2hkia1, d2hkia2
  • Heterogens: SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hkiA (A:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hkiA (A:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankw