PDB entry 2hkh

View 2hkh on RCSB PDB site
Description: Crystal structure of the Fab M75
Class: immune system
Keywords: Immunoglobulin, Fab fragment, immune system
Deposited on 2006-07-04, released 2007-11-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Immunoglobulin Heavy chain Fab fragment
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2HKH (Start-217)
  • Chain 'L':
    Compound: Immunoglobulin Light chain Fab fragment
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2HKH (0-218)
    Domains in SCOPe 2.07: d2hkhl1, d2hkhl2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hkhL (L:)
    dvvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspnlliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpftfgsgtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec