PDB entry 2hka

View 2hka on RCSB PDB site
Description: Crystal structure of bovine NPC2 and cholesterol sulfate complex
Class: lipid binding protein
Keywords: beta barrel
Deposited on 2006-07-03, released 2007-06-26
The last revision prior to the SCOP 1.75 freeze date was dated 2007-08-28, with a file datestamp of 2007-08-24.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.195
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epididymal secretory protein E1
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hkaa1
  • Chain 'B':
    Compound: Epididymal secretory protein E1
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hkab1
  • Chain 'C':
    Compound: Epididymal secretory protein E1
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hkac1
  • Heterogens: NAG, ACT, SO4, C3S, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hkaA (A:)
    epvkfkdcgswvgvikevnvspcptqpcklhrgqsysvnvtftsntqsqsskavvhgivm
    gipvpfpipesdgcksgircpiekdktynyvnklpvkneypsikvvveweltddknqrff
    cwqipievea
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hkaB (B:)
    epvkfkdcgswvgvikevnvspcptqpcklhrgqsysvnvtftsntqsqsskavvhgivm
    gipvpfpipesdgcksgircpiekdktynyvnklpvkneypsikvvveweltddknqrff
    cwqipievea
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hkaC (C:)
    epvkfkdcgswvgvikevnvspcptqpcklhrgqsysvnvtftsntqsqsskavvhgivm
    gipvpfpipesdgcksgircpiekdktynyvnklpvkneypsikvvveweltddknqrff
    cwqipievea