PDB entry 2hk6

View 2hk6 on RCSB PDB site
Description: Crystal Structure of B. subtilis ferrochelatase with Iron bound at the active site
Class: lyase
Keywords: Heme biosynthesis, Iron, Metal-binding, Porphyrin biosynthesis, LYASE
Deposited on 2006-07-03, released 2007-01-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: 0.178
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferrochelatase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: hemH, hemF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2hk6a_
  • Heterogens: FE, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hk6A (A:)
    msrkkmgllvmaygtpykeedieryythirrgrkpepemlqdlkdryeaiggisplaqit
    eqqahnleqhlneiqdeitfkayiglkhiepfiedavaemhkdgiteavsivlaphfstf
    svqsynkrakeeaeklggltitsveswydepkfvtywvdrvketyasmpederenamliv
    sahslpekikefgdpypdqlhesakliaegagvseyavgwqsegntpdpwlgpdvqdltr
    dlfeqkgyqafvyvpvgfvadhlevlydndyeckvvtddigasyyrpempnakpefidal
    atvvlkklgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hk6A (A:)
    srkkmgllvmaygtpykeedieryythirrgrkpepemlqdlkdryeaiggisplaqite
    qqahnleqhlneiqdeitfkayiglkhiepfiedavaemhkdgiteavsivlaphfstfs
    vqsynkrakeeaeklggltitsveswydepkfvtywvdrvketyasmpederenamlivs
    ahslpekikefgdpypdqlhesakliaegagvseyavgwqsegntpdpwlgpdvqdltrd
    lfeqkgyqafvyvpvgfvadhlevlydndyeckvvtddigasyyrpempnakpefidala
    tvvlkklgr