PDB entry 2hjj

View 2hjj on RCSB PDB site
Description: Solution NMR structure of protein ykfF from Escherichia coli. Northeast Structural Genomics target ER397.
Class: structural genomics, unknown function
Keywords: ER397, NMR structure, Northeast Structural Genomics Consortium (NESG), Protein Structure Initiative., PSI-2
Deposited on 2006-06-30, released 2006-08-29
The last revision prior to the SCOP 1.75 freeze date was dated 2006-08-29, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hypothetical protein ykfF
  Species: Escherichia coli
  Gene: ykfF
  Database cross-references and differences (RAF-indexed):
  • Uniprot P75677
  Domains in SCOP 1.75: d2hjja1

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2hjjA (A:)
  mtqsvllppgpftrrqaqavtttysnitleddqgshfrlvvrdtegrmvwrawnfepdag
  eglnryirtsgirtdtatrlehhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2hjjA (A:)
  gpftrrqaqavtttysnitleddqgshfrlvvrdtegrmvwrawnfepdageglnryirt
  sgirtd