PDB entry 2hjf

View 2hjf on RCSB PDB site
Description: Potassium channel kcsa-fab complex with tetrabutylammonium (TBA)
Class: metal transport
Keywords: Potassium Channel, Ion transport, METAL TRANSPORT
Deposited on 2006-06-30, released 2006-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.225
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Antibody fragment Heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2HJF (0-218)
    Domains in SCOPe 2.07: d2hjfa1, d2hjfa2, d2hjfa3
  • Chain 'B':
    Compound: Antibody fragment Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2HJF (0-211)
    Domains in SCOPe 2.07: d2hjfb1, d2hjfb2
  • Chain 'C':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces lividans [TaxId:1916]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334 (0-102)
      • engineered (68)
    Domains in SCOPe 2.07: d2hjfc_
  • Heterogens: K, TBA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hjfA (A:)
    qvqlqqpgaelvkpgasvklsckasgytftsdwihwvkqrpghglewigeiipsygrany
    nekiqkkatltadkssstafmqlssltsedsavyycarergdgyfavwgagttvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpssswpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hjfB (B:)
    dilltqspailsvspgervsfscrasqsigtdihwyqqrtngsprllikyasesisgips
    rfsgsgsgtdftlsinsvesedianyycqqsnrwpftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hjfC (C:)
    salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
    ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh