PDB entry 2hje

View 2hje on RCSB PDB site
Description: Crystal structure of Vibrio harveyi LuxQ periplasmic domain
Class: signaling protein
Keywords: per/arnt/simple-minded (pas) fold, autoinducer-2 (ai-2), quorum sensing, histidine sensor kinase, signaling protein
Deposited on 2006-06-30, released 2006-09-26
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.197
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Autoinducer 2 sensor kinase/phosphatase luxQ
    Species: Vibrio harveyi [TaxId:669]
    Gene: luxQ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54302 (2-220)
      • see remark 999 (1)
    Domains in SCOPe 2.01: d2hjea_
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hjeA (A:)
    gskqqtsalihnifdshfaaiqihhdsnsksevirdfytdrdtdvlnffflsidqsdpsh
    tpefrfltdhkgiiwddgnahfygvndlildslanrvsfsnnwyyinvmtsigsrhmlvr
    rvpildpstgevlgfsfnavvldnnfalmeklksesnvdnvvlvansvplansligdepy
    nvadvlqrkssdkrldkllvietpivvnavttelclltvqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hjeA (A:)
    skqqtsalihnifdshfaaiqihhdsnsksevirdfytdrdtdvlnffflsidqsdpsht
    pefrfltdhkgiiwddgnahfygvndlildslanrvsfsnnwyyinvmtsigsrhmlvrr
    vpildpstgevlgfsfnavvldnnfalmeklksesnvdnvvlvansvplansligdepyn
    vadvlqllvietpivvnavttelclltvqd