PDB entry 2hj1

View 2hj1 on RCSB PDB site
Description: Crystal structure of a 3D domain-swapped dimer of protein HI0395 from Haemophilus influenzae
Class: structural genomics, unknown function
Keywords: structural genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, UNKNOWN FUNCTION
Deposited on 2006-06-29, released 2006-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Haemophilus influenzae [TaxId:281310]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hj1a1
  • Chain 'B':
    Compound: hypothetical protein
    Species: Haemophilus influenzae [TaxId:281310]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4QNE7 (10-End)
      • cloning artifact (9)
    Domains in SCOPe 2.07: d2hj1b2, d2hj1b3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hj1A (A:)
    mahhhhhhslnqinieiayafperyylksfqvdegitvqtaitqsgilsqfpeidlstnk
    igifsrpikltdvlkegdrieiyrplladpkeirreg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hj1A (A:)
    nqinieiayafperyylksfqvdegitvqtaitqsgilsqfpeidlstnkigifsrpikl
    tdvlkegdrieiyrpll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hj1B (B:)
    mahhhhhhslnqinieiayafperyylksfqvdegitvqtaitqsgilsqfpeidlstnk
    igifsrpikltdvlkegdrieiyrplladpkeirreg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hj1B (B:)
    lnqinieiayafperyylksfqvdegitvqtaitqsgilsqfpeidlstnkigifsrpik
    ltdvlkegdrieiyrpllad