PDB entry 2hiw

View 2hiw on RCSB PDB site
Description: Crystal Structure of Inactive Conformation Abl Kinase Catalytic Domain Complexed with Type II Inhibitor
Class: transferase
Keywords: kinase domain, transferase
Deposited on 2006-06-29, released 2006-08-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.246
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase ABL1
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL1, ABL, JTK7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00519 (4-End)
      • cloning artifact (0-3)
    Domains in SCOPe 2.06: d2hiwa1, d2hiwa2
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase ABL1
    Species: Homo sapiens [TaxId:9606]
    Gene: ABL1, ABL, JTK7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00519 (4-End)
      • cloning artifact (0-3)
    Domains in SCOPe 2.06: d2hiwb1, d2hiwb2
  • Heterogens: 7MP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hiwA (A:)
    gamdpnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflk
    eaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymat
    qissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikw
    tapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcp
    ekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hiwA (A:)
    gamdpnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflk
    eaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymat
    qissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikw
    tapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcp
    ekvyelmracwqwnpsdrpsfaeihqafetmfqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hiwB (B:)
    gamdpnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflk
    eaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymat
    qissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikw
    tapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcp
    ekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hiwB (B:)
    gamdpnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflk
    eaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymat
    qissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikw
    tapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcp
    ekvyelmracwqwnpsdrpsfaeihqafetmfqe