PDB entry 2his

View 2his on RCSB PDB site
Description: cellulomonas fimi xylanase/cellulase double mutant e127a/h205n with covalent cellobiose
Class: hydrolase
Keywords: hydrolase, o-glycosyl, xylanase/cellulase, a/b barrel
Deposited on 1998-02-23, released 1998-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.22
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellulomonas fimi family 10 beta-1,4-glycanase
    Species: CELLULOMONAS FIMI [TaxId:1708]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07986 (0-311)
      • engineered (126)
      • conflict (132)
      • conflict (134-135)
      • engineered (204)
    Domains in SCOPe 2.07: d2hisa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hisA (A:)
    attlkeaadgagrdfgfaldpnrlseaqykaiadsefnlvvaenamkwdatepsqnsfsf
    gagdrvasyaadtgkelyghtlvwhsqlpdwaknlngsafesamvnhvtkvadhfegkva
    swdvvnaafadgggrrqdsafqqklgngyietafraaraadptaklcindynveginaks
    nslydlvkdfkargvpldcvgfqsnlivgqvpgdfrqnlqrfadlgvdvriteldirmrt
    psdatklatqaadykkvvqacmqvtrcqgvtvwgitdkyswvpdvfpgegaalvwdasya
    kkpayaavmeaf