PDB entry 2hiq

View 2hiq on RCSB PDB site
Description: Crystal structure of JW1657 from Escherichia coli
Class: structural genomics, unknown function
Keywords: HYPOTHETICAL PROTEIN JW1657, STRUCTURAL GENOMICS, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG
Deposited on 2006-06-29, released 2006-09-12
The last revision prior to the SCOP 1.75 freeze date was dated 2006-09-12, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.249
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein ydhR
    Species: Escherichia coli
    Gene: ydhR
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hiqa1
  • Chain 'B':
    Compound: Hypothetical protein ydhR
    Species: Escherichia coli
    Gene: ydhR
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hiqb1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hiqA (A:)
    mtdpalraatllqlhfafngpfgdamaeqlkplaesinqepgflwkvwteseknheaggi
    ylftdeksalaylekhtarlknlgveevvakvfdvneplsqinqaklaglcgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hiqA (A:)
    atllqlhfafngpfgdamaeqlkplaesinqepgflwkvwteseknheaggiylftdeks
    alaylekhtarlknlgveevvakvfdvneplsqinq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hiqB (B:)
    mtdpalraatllqlhfafngpfgdamaeqlkplaesinqepgflwkvwteseknheaggi
    ylftdeksalaylekhtarlknlgveevvakvfdvneplsqinqaklaglcgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hiqB (B:)
    atllqlhfafngpfgdamaeqlkplaesinqepgflwkvwteseknheaggiylftdeks
    alaylekhtarlknlgveevvakvfdvneplsqinq