PDB entry 2hio

View 2hio on RCSB PDB site
Description: histone octamer (chicken), chromosomal protein
Deposited on 1999-06-15, released 2000-01-12
The last revision prior to the SCOP 1.71 freeze date was dated 2000-01-12, with a file datestamp of 2000-01-11.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.255
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d2hioa_
  • Chain 'B':
    Domains in SCOP 1.71: d2hiob_
  • Chain 'C':
    Domains in SCOP 1.71: d2hioc_
  • Chain 'D':
    Domains in SCOP 1.71: d2hiod_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hioA (A:)
    sgrgkqggkarakaksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylta
    eilelagnaardnkktriiprhlqlairndeelnkllgkvtiaqggvlpniqavllpkkt
    dshkakak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hioA (A:)
    ksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardnk
    ktriiprhlqlairndeelnkllgkvtiaqggvlpniqavl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hioB (B:)
    pepaksapapkkgskkavtktqkkgdkkrkksrkesysiyvykvlkqvhpdtgisskamg
    imnsfvndiferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtk
    ytssk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hioB (B:)
    sysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstitsreiq
    tavrlllpgelakhavsegtkavtkytssk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2hioC (C:)
    martkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkste
    llirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvglfedtnlcaihakrvti
    mpkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hioC (C:)
    pgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvg
    lfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2hioD (D:)
    msgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlk
    vflenvirdavtytehakrktvtamdvvyalkrqertlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hioD (D:)
    niqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvtam
    dvvyalkrqertlygfgg