PDB entry 2hi7

View 2hi7 on RCSB PDB site
Description: Crystal structure of DsbA-DsbB-ubiquinone complex
Class: oxidoreductase
Keywords: disulfide bond, redox, DsbB, membrane protein, ubiquinone, oxidative protein folding, OXIDOREDUCTASE
Deposited on 2006-06-29, released 2006-12-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.7 Å
R-factor: 0.342
AEROSPACI score: -0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiol:disulfide interchange protein dsbA
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AEG4 (0-End)
      • engineered (32)
    Domains in SCOPe 2.06: d2hi7a1
  • Chain 'B':
    Compound: Disulfide bond formation protein B
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6M2
      • engineered (48)
    Domains in SCOPe 2.06: d2hi7b1
  • Heterogens: ZN, UQ1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hi7A (A:)
    aqyedgkqyttlekpvagapqvleffsffcphayqfeevlhisdnvkkklpegvkmtkyh
    vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
    eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
    tvkylsekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hi7A (A:)
    aqyedgkqyttlekpvagapqvleffsffcphayqfeevlhisdnvkkklpegvkmtkyh
    vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
    eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
    tvkylsek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hi7B (B:)
    mlrflnqasqgrgawllmaftalaleltalwfqhvmllkpcvlciyervalfgvlgaali
    gaiapktplryvamviwlysafrgvqltyehtmlqlypspfatcdfmvrfpewlpldkwv
    pqvfvasgdsaerqwdflglempqwllgifiaylivavlvvisqpfkakkrdlfgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hi7B (B:)
    awllmaftalaleltalwfqhvmllkpcvlciyervalfgvlgaaligaiapktplryva
    mviwlysafrgvqltyehtmlqlypspfatcdfmvrfpewlpldkwvpqvfvampqwllg
    ifiaylivavlvvi