PDB entry 2hi5

View 2hi5 on RCSB PDB site
Description: Model for bacteriophage fd from cryo-EM
Class: virus
Keywords: helix, helical VIRUS, structural protein, DNA binding protein
Deposited on 2006-06-29, released 2007-08-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-08-11, with a file datestamp of 2009-08-07.
Experiment type: EM
Resolution: 8 Å
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: coat protein b
  Species: Enterobacteria phage fd [TaxId:10864]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P69539
  Domains in SCOPe 2.06: d2hi5a1

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2hi5A (A:)
  aegddpakaafdslqasateyigyawamvvvivgatigiklfkkftskas
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2hi5A (A:)
  pakaafdslqasateyigyawamvvvivgatigiklfkkfts