PDB entry 2hi2

View 2hi2 on RCSB PDB site
Description: Crystal structure of native Neisseria gonorrhoeae Type IV pilin at 2.3 Angstroms Resolution
Class: cell adhesion
Keywords: TYPE IV PILIN, FIBER-FORMING PROTEIN, membrane protein, DNA binding protein, contractile protein, CELL ADHESION
Deposited on 2006-06-28, released 2006-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-06-23, with a file datestamp of 2010-06-18.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.259
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fimbrial protein
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02974 (0-157)
      • see remark 999 (68)
      • see remark 999 (70)
    Domains in SCOPe 2.07: d2hi2a_
  • Heterogens: HTO, OPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hi2A (A:)
    ftlielmiviaivgilaavalpayqdytaraqvseaillaegqksavteyylnhgkwpen
    ntsagvassptdikgkyvkevevkngvvtatmlssgvnneikgkklslwarrengsvkwf
    cgqpvtrtdddtvadakdgkeidtkhlpstcrdnfdak