PDB entry 2hi1

View 2hi1 on RCSB PDB site
Description: The structure of a putative 4-hydroxythreonine-4-phosphate dehydrogenase from Salmonella typhimurium.
Class: structural genomics, unknown function
Keywords: Pyridoxal phosphate biosynthesis, Salmonella Typhimurium, 4-hydroxythreonine-4-phosphate dehydrogenase, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2006-06-28, released 2006-07-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.191
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-hydroxythreonine-4-phosphate dehydrogenase 2
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: pdxA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58718 (Start-329)
      • modified residue (12)
      • modified residue (156)
      • modified residue (242)
      • modified residue (264)
      • modified residue (268)
      • modified residue (318)
      • modified residue (326)
    Domains in SCOPe 2.03: d2hi1a_
  • Chain 'B':
    Compound: 4-hydroxythreonine-4-phosphate dehydrogenase 2
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: pdxA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58718 (Start-329)
      • modified residue (12)
      • modified residue (156)
      • modified residue (242)
      • modified residue (264)
      • modified residue (268)
      • modified residue (318)
      • modified residue (326)
    Domains in SCOPe 2.03: d2hi1b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hi1A (A:)
    snametktvaitmgdpagigpeiivkalsedglngaplvvigclatlkrlqakgitpnve
    lraiervaearfapgiihvideplaqpealeagkvqaqagdlayrcvkratelalrgdvq
    aiataplnkealhlaghnypghtellatlthsrdyamvlytdklkvihvsthialrkfld
    tlstarvetvigiadtflkrvgyvkpriavagvnphagenglfgdeetriltpaitdara
    kgmdvygpcppdtvflqayegqydmvvamyhdqghiplkllgfydgvnitaglpfirtsa
    dhgtafdiawtgkaksesmavsiklamqla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hi1A (A:)
    etktvaitmgdpagigpeiivkalsedglngaplvvigclatlkrlqakgitpnvelrai
    ervaearfapgiihvideplaqpealeagkvqaqagdlayrcvkratelalrgdvqaiat
    aplnkealhlaghnypghtellatlthsrdyamvlytdklkvihvsthialrkfldtlst
    arvetvigiadtflkrvgyvkpriavagvnphagenglfgdeetriltpaitdarakgmd
    vygpcppdtvflqayegqydmvvamyhdqghiplkllgydgvnitaglpfirtsadhgta
    fdiawtgkaksesmavsiklamqla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hi1B (B:)
    snametktvaitmgdpagigpeiivkalsedglngaplvvigclatlkrlqakgitpnve
    lraiervaearfapgiihvideplaqpealeagkvqaqagdlayrcvkratelalrgdvq
    aiataplnkealhlaghnypghtellatlthsrdyamvlytdklkvihvsthialrkfld
    tlstarvetvigiadtflkrvgyvkpriavagvnphagenglfgdeetriltpaitdara
    kgmdvygpcppdtvflqayegqydmvvamyhdqghiplkllgfydgvnitaglpfirtsa
    dhgtafdiawtgkaksesmavsiklamqla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hi1B (B:)
    tktvaitmgdpagigpeiivkalsedglngaplvvigclatlkrlqakgitpnvelraie
    rvaearfapgiihvideplaqpealeagkvqaqagdlayrcvkratelalrgdvqaiata
    plnkealhlaghnypghtellatlthsrdyamvlytdklkvihvsthialrkfldtlsta
    rvetvigiadtflkrvgyvkpriavagvnphaglfgdeetriltpaitdarakgmdvygp
    cppdtvflqayegqydmvvamyhdqghiplkllgfdgvnitaglpfirtsadhgtafdia
    wtgkaksesmavsiklamqla